| Product Number |
ARP31974_P050-FITC |
| Product Page |
www.avivasysbio.com/chx10-antibody-c-terminal-region-fitc-arp31974-p050-fitc.html |
| Name |
CHX10 Antibody - C-terminal region : FITC (ARP31974_P050-FITC) |
| Protein Size (# AA) |
361 amino acids |
| Molecular Weight |
39kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
338917 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Visual system homeobox 2 |
| Alias Symbols |
RET1, CHX10, HOX10, MCOP2, MCOPCB3 |
| Peptide Sequence |
Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Ferda Percin,E., et al., (2000) Nat. Genet. 25 (4), 397-401 |
| Description of Target |
Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development. |
| Protein Interactions |
PAX6; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-VSX2 (ARP31974_P050-FITC) antibody |
| Blocking Peptide |
For anti-VSX2 (ARP31974_P050-FITC) antibody is Catalog # AAP31974 (Previous Catalog # AAPP02871) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CHX10 |
| Uniprot ID |
P58304 |
| Protein Name |
Visual system homeobox 2 |
| Protein Accession # |
NP_878314 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182894 |
| Gene Symbol |
VSX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92% |
| Image 1 | |
|
