Search Antibody, Protein, and ELISA Kit Solutions

CHX10 Antibody - C-terminal region : FITC (ARP31974_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31974_P050 Unconjugated

ARP31974_P050-HRP Conjugated

ARP31974_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-119257 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CHX10
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-CHX10 (ARP31974_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-VSX2 (ARP31974_P050-FITC) antibody is Catalog # AAP31974 (Previous Catalog # AAPP02871)
Datasheets/Manuals:
Printable datasheet for anti-VSX2 (ARP31974_P050-FITC) antibody
Target Reference:
Ferda Percin,E., et al., (2000) Nat. Genet. 25 (4), 397-401
Gene Symbol:
VSX2
Official Gene Full Name:
Visual system homeobox 2
Alias Symbols:
CHX10, HOX10, MCOP2, MCOPCB3, RET1
NCBI Gene Id:
338917
Protein Name:
Visual system homeobox 2
Description of Target:
Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.
Swissprot Id:
P58304
Protein Accession #:
NP_878314
Nucleotide Accession #:
NM_182894
Protein Size (# AA):
361
Molecular Weight:
39kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHX10.
Protein Interactions:
PAX6;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...