Product Number |
ARP31974_P050 |
Product Page |
www.avivasysbio.com/chx10-antibody-c-terminal-region-arp31974-p050.html |
Name |
CHX10 Antibody - C-terminal region (ARP31974_P050) |
Protein Size (# AA) |
361 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
338917 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Visual system homeobox 2 |
Alias Symbols |
RET1, CHX10, HOX10, MCOP2, MCOPCB3 |
Peptide Sequence |
Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ferda Percin,E., et al., (2000) Nat. Genet. 25 (4), 397-401 |
Description of Target |
Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development. |
Protein Interactions |
PAX6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-VSX2 (ARP31974_P050) antibody |
Blocking Peptide |
For anti-VSX2 (ARP31974_P050) antibody is Catalog # AAP31974 (Previous Catalog # AAPP02871) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CHX10 |
Uniprot ID |
P58304 |
Protein Name |
Visual system homeobox 2 |
Protein Accession # |
NP_878314 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_182894 |
Tested Species Reactivity |
Human |
Gene Symbol |
VSX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-CHX10 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|
|