Search Antibody, Protein, and ELISA Kit Solutions

CHX10 Antibody - C-terminal region (ARP31974_P050)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31974_P050-FITC Conjugated

ARP31974_P050-HRP Conjugated

ARP31974_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
VSX2
Official Gene Full Name:
Visual system homeobox 2
NCBI Gene Id:
338917
Protein Name:
Visual system homeobox 2
Swissprot Id:
P58304
Protein Accession #:
NP_878314
Nucleotide Accession #:
NM_182894
Alias Symbols:
CHX10, HOX10, MCOP2, MCOPCB3, RET1
Replacement Item:
This antibody may replace item sc-119257 from Santa Cruz Biotechnology.
Description of Target:
Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.
Protein Size (# AA):
361
Molecular Weight:
39kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHX10.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CHX10
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-CHX10 (ARP31974_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PAX6;
Blocking Peptide:
For anti-VSX2 (ARP31974_P050) antibody is Catalog # AAP31974 (Previous Catalog # AAPP02871)
Datasheets/Manuals:
Printable datasheet for anti-VSX2 (ARP31974_P050) antibody
Target Reference:
Ferda Percin,E., et al., (2000) Nat. Genet. 25 (4), 397-401

Product Reviews

Average Rating:
1 review
5 star
0
4 star
0
3 star
1
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

50/02/2019 01:34
  • Overall Experience:
  • Quality:
Human retina in WB

Submitted by:
Bryce McLelland 

University of California, Irvine

“Overall experience was good, CHX10 worked very well”

CHX10

1. Sample type/lane description: 10 ug human retina

2. Primary antibody dilution: 1:500

3. Secondary antibody and dilution: Donkey anti-rabbit-HRP, 1:2000

4. Protocol:
- 10.5% Gel used to polymerization
- Lower gel polymerize for 1 hour
- Upper gel polymerize for 10-30 minutes
- Laemmli Running buffer used to fill space inside plates
- Gel ran for 90 minutes under 190V
- Gel placed in Western Transfer Buffer when finished
- Western blot transfer ran overnight under 45V
- Blocking solution: 5% Blotto + PBS-Tween
- Primaries were incubated overnight in the fridge with shaking
- Secondary’s were incubated for 75-90 minutes
- Development was for 10 minutes followed with 10 minute exposure.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...