Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP31974_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31974_P050-FITC Conjugated

ARP31974_P050-HRP Conjugated

ARP31974_P050-Biotin Conjugated

CHX10 Antibody - C-terminal region (ARP31974_P050)

Rating:
60% of 100
Catalog#: ARP31974_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-119257 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CHX10
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data Anti-CHX10 (ARP31974_P050)
Peptide Sequence Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-VSX2 (ARP31974_P050) antibody is Catalog # AAP31974 (Previous Catalog # AAPP02871)
Datasheets/Manuals Printable datasheet for anti-VSX2 (ARP31974_P050) antibody
Target Reference Ferda Percin,E., et al., (2000) Nat. Genet. 25 (4), 397-401
Gene Symbol VSX2
Official Gene Full Name Visual system homeobox 2
Alias Symbols CHX10, HOX10, MCOP2, MCOPCB3, RET1
NCBI Gene Id 338917
Protein Name Visual system homeobox 2
Description of Target Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.
Swissprot Id P58304
Protein Accession # NP_878314
Nucleotide Accession # NM_182894
Protein Size (# AA) 361
Molecular Weight 39kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHX10.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHX10.
Protein Interactions PAX6;
Write Your Own Review
You're reviewing:CHX10 Antibody - C-terminal region (ARP31974_P050)
Your Rating