DYRK3 Antibody - N-terminal region (ARP30648_P050)

• Product Number: ARP30648_P050
• Name: DYRK3 Antibody - N-terminal region (ARP30648_P050)
• Protein Size (# AA): 588 amino acids
• Molecular Weight: 66 kDa
• NCBI Gene Id: 8444
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
• Alias Symbols: RED, REDK, DYRK5, hYAK3-2
• Peptide Sequence: Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Protein Interactions: DYRK3; SORL1; FBXO25; PRNP; NEDD4L;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-DYRK3 (ARP30648_P050) antibody is Catalog # AAP30648 (Previous Catalog # AAPP01305)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
• Uniprot ID: O43781
• Protein Name: Dual specificity tyrosine-phosphorylation-regulated kinase 3
• Publications:

  Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFbeta-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). 23415227

• Protein Accession #: NP_003573
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003582
• Tested Species Reactivity: Human
• Gene Symbol: DYRK3
• Predicted Species Reactivity: Human, Mouse
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 86%
• Image 1: HeLas
  
  Sample Type:
  HeLa cells
  Primary Antibody Dilution:
  1:50
  Secondary Antibody:
  Gaot anti-rabbit-Alexa Fluor
  Secondary Antibody Dilution:
  1:250
  Color/Signal Descriptions:
  Green: DYRK3 Red: PABP1 Blue: DAPI
  Gene Name:
  DYRK3
  Submitted by:
  Frank Wippich, Institute of Molecular Life Sciences, University of Zurich
• Image 2: Human THP-1
  
  WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: THP-1 cell lysate