SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30648_P050
Price: $0.00
SKU
ARP30648_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DYRK3 (ARP30648_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 86%
Peptide SequenceSynthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
Concentration0.5 mg/ml
Blocking PeptideFor anti-DYRK3 (ARP30648_P050) antibody is Catalog # AAP30648 (Previous Catalog # AAPP01305)
Enhanced Validation
WBY
SPR
YCHAROS
Publications

Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFbeta-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). 23415227

Gene SymbolDYRK3
Gene Full NameDual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Alias SymbolsRED, REDK, DYRK5, hYAK3-2
NCBI Gene Id8444
Protein NameDual specificity tyrosine-phosphorylation-regulated kinase 3
Description of TargetThis gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDO43781
Protein Accession #NP_003573
Nucleotide Accession #NM_003582
Protein Size (# AA)588
Molecular Weight66 kDa
Protein InteractionsDYRK3; SORL1; FBXO25; PRNP; NEDD4L;
  1. What is the species homology for "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse".

  2. How long will it take to receive "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DYRK3 Antibody - N-terminal region (ARP30648_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    This target may also be called "RED, REDK, DYRK5, hYAK3-2" in publications.

  5. What is the shipping cost for "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66 kDa ".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DYRK3 Antibody - N-terminal region (ARP30648_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DYRK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DYRK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DYRK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DYRK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DYRK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DYRK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DYRK3 Antibody - N-terminal region (ARP30648_P050)
Your Rating
We found other products you might like!