Search Antibody, Protein, and ELISA Kit Solutions

DYRK3 antibody - N-terminal region (ARP30648_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30648_P050-FITC Conjugated

ARP30648_P050-HRP Conjugated

ARP30648_P050-Biotin Conjugated

Gene Symbol:
DYRK3
NCBI Gene Id:
8444
Official Gene Full Name:
Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Protein Name:
Dual specificity tyrosine-phosphorylation-regulated kinase 3
Swissprot Id:
O43781
Protein Accession #:
NP_003573
Nucleotide Accession #:
NM_003582
Alias Symbols:
DYRK5, RED, REDK, hYAK3-2
Replacement Item:
This antibody may replace item sc-18954 from Santa Cruz Biotechnology.
Description of Target:
This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
588
Molecular Weight:
66kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DYRK3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DYRK3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 86%
Complete computational species homology data:
Anti-DYRK3 (ARP30648_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DYRK3; SORL1; FBXO25; PRNP; NEDD4L;
Blocking Peptide:
For anti-DYRK3 (ARP30648_P050) antibody is Catalog # AAP30648 (Previous Catalog # AAPP01305)
Datasheets/Manuals:
Printable datasheet for anti-DYRK3 (ARP30648_P050) antibody
Publications:

Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFβ-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). IF, WB, Human, Mouse 23415227

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...