DYRK3 Antibody - N-terminal region (ARP30648_P050)

Catalog No: ARP30648_P050

WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate

Sample Type:
HeLa cells
Primary Antibody Dilution:
1:50
Secondary Antibody:
Gaot anti-rabbit-Alexa Fluor
Secondary Antibody Dilution:
1:250
Color/Signal Descriptions:
Green: DYRK3 Red: PABP1 Blue: DAPI
Gene Name:
DYRK3
Submitted by:
Frank Wippich, Institute of Molecular Life Sciences, University of Zurich

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IF, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DYRK3 (ARP30648_P050) antibody is Catalog # AAP30648 (Previous Catalog # AAPP01305)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Publications:

  Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFbeta-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). 23415227

Target Info

• Gene Symbol: DYRK3
• Gene Full Name: Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
• Alias Symbols: RED, REDK, DYRK5, hYAK3-2
• NCBI Gene Id: 8444
• Protein Name: Dual specificity tyrosine-phosphorylation-regulated kinase 3
• Description of Target: This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: O43781
• Protein Accession #: NP_003573
• Nucleotide Accession #: NM_003582
• Protein Size (# AA): 588
• Molecular Weight: 66 kDa
• Protein Interactions: DYRK3; SORL1; FBXO25; PRNP; NEDD4L;