Product Number |
ARP30091_P050 |
Product Page |
www.avivasysbio.com/tcf7l1-antibody-c-terminal-region-arp30091-p050.html |
Name |
TCF7L1 Antibody - C-terminal region (ARP30091_P050) |
Protein Size (# AA) |
588 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
83439 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
transcription factor 7 like 1 |
Alias Symbols |
TCF3, TCF-3 |
Peptide Sequence |
Synthetic peptide located within the following region: LHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence. |
Protein Interactions |
UBC; mdfic; Mdfi; DAZAP2; CTNNB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TCF7L1 (ARP30091_P050) antibody |
Blocking Peptide |
For anti-TCF7L1 (ARP30091_P050) antibody is Catalog # AAP30091 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TF7L1 |
Uniprot ID |
Q9HCS4 |
Protein Name |
transcription factor 7-like 1 |
Protein Accession # |
NP_112573 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
TCF7L1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100% |
Image 1 | Human Lung Tumor
| Host: Rabbit Target Name: TF7L1 Sample Type: Lung Tumor lysates Antibody Dilution: 1.0ug/ml |
|
|