| Sku |
AAP30091 |
| Price |
$99.00 |
| Name |
TCF7L1 Peptide - C-terminal region (AAP30091) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TCF7L1 |
| Alias symbols |
TCF3, TCF-3 |
| Gene id |
83439 |
| Description of target |
This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence. |
| Swissprot id |
Q9HCS4 |
| Protein accession num |
NP_112573 |
| Protein size |
588 amino acids |
| Molecular weight |
64kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
Synthetic peptide located within the following region: LHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKP |
| Partner proteins |
UBC; mdfic; Mdfi; DAZAP2; CTNNB1; |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TF7L1 Antibody (ARP30091_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
