CDK2 Peptide - middle region (AAPP45995)

Data Sheet
 
Sku AAPP45995
Price $99.00
Name CDK2 Peptide - middle region (AAPP45995)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CDK2
Alias symbols p33(CDK2)
Gene id 1017
Description of target Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.
Swissprot id P24941
Protein accession num NP_001789
Nucleotide accession num NM_001798
Protein size 298 amino acids
Molecular weight 34kDa
Species reactivity Human
Application WB
Peptide sequence VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Partner proteins BRCA1,CCNA2,CCNA2,CCNA2,RB1,SMAD2,SMAD3,MITF,BCL2,BRCA1,BRCA2,CCNA1,CCNA2,CCNB2,CCNB3,CCNE1,CCNE2,CCNH,CCNK,CCP110,CDC25A,CDC37,CDC6,CDC7,CDK2,CDK20,CDK2AP1,CDK7,CDKN1A,CDKN1B,CDKN3,CDT1,CDX2,CEBPA,CHAF1A,CHAF1B,CKS1B,CNOT7,COIL,EP300,FEN1,FOXM1,FZR1,HIRA
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CDK2 Antibody (ARP30331_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com