Sku |
AAPP45995 |
Price |
$99.00 |
Name |
CDK2 Peptide - middle region (AAPP45995) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CDK2 |
Alias symbols |
p33(CDK2) |
Gene id |
1017 |
Description of target |
Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2. |
Swissprot id |
P24941 |
Protein accession num |
NP_001789 |
Nucleotide accession num |
NM_001798 |
Protein size |
298 amino acids |
Molecular weight |
34kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE |
Partner proteins |
BRCA1,CCNA2,CCNA2,CCNA2,RB1,SMAD2,SMAD3,MITF,BCL2,BRCA1,BRCA2,CCNA1,CCNA2,CCNB2,CCNB3,CCNE1,CCNE2,CCNH,CCNK,CCP110,CDC25A,CDC37,CDC6,CDC7,CDK2,CDK20,CDK2AP1,CDK7,CDKN1A,CDKN1B,CDKN3,CDT1,CDX2,CEBPA,CHAF1A,CHAF1B,CKS1B,CNOT7,COIL,EP300,FEN1,FOXM1,FZR1,HIRA |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CDK2 Antibody (ARP30331_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |