| Sku |
AAP89382 |
| Price |
99 |
| Name |
MMP12 Peptide - middle region (AAP89382) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MMP12 |
| Alias symbols |
MME, Mmel, AV378681 |
| Gene id |
17381 |
| Description of target |
This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme. Mice lacking the encoded protein have a diminished capacity to degrade extracellular matrix components, do not develop emphysema in response to long-term exposure to cigarette smoke, and exhibit impaired clearance and increased mortality upon bacterial infection. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. Alternate splicing generates multiple transcript variants encoding distinct isoforms. |
| Swissprot id |
P34960 |
| Protein accession num |
NP_001307005.1 |
| Nucleotide accession num |
NM_001320076.1 |
| Protein size |
473 amino acids |
| Molecular weight |
52 kDa |
| Species reactivity |
Mouse |
| Peptide sequence |
Synthetic peptide located within the following region: STFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSI |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- MMP12 Antibody (ARP89382_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
