GCHFR Peptide - middle region (AAP88307)

Data Sheet
 
Sku AAP88307
Price 99
Name GCHFR Peptide - middle region (AAP88307)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene GCHFR
Alias symbols P35, GFRP, HsT16933
Gene id 2644
Description of target GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
Swissprot id P30047
Protein accession num NP_005249.1
Nucleotide accession num NM_005258.2
Protein size 84 amino acids
Molecular weight 9 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- GCHFR Antibody (ARP88307_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com