Sku |
AAP87531 |
Price |
99 |
Name |
HDGF Peptide - middle region (AAP87531) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
HDGF |
Alias symbols |
HMG1L2 |
Gene id |
3068 |
Description of target |
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Swissprot id |
P51858-2 |
Protein accession num |
NP_001119522.1 |
Nucleotide accession num |
NM_001126050.1 |
Protein size |
233 amino acids |
Molecular weight |
25 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: THETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQ |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- HDGF Antibody (ARP87531_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |