| Sku |
AAP86964 |
| Price |
99 |
| Name |
ACE2 Peptide - C-terminal region (AAP86964) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ACE2 |
| Alias symbols |
ACEH |
| Gene id |
59272 |
| Description of target |
The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. |
| Swissprot id |
Q9BYF1 |
| Protein accession num |
NP_068576.1 |
| Nucleotide accession num |
NM_021804.2 |
| Protein size |
805 amino acids |
| Molecular weight |
88 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: PNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYAS |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- ACE2 Antibody (ARP86964_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
