| Sku |
AAP81502 |
| Price |
99 |
| Name |
KALRN Peptide - middle region (AAP81502) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
KALRN |
| Alias symbols |
DUO, CHD5, DUET, TRAD, CHDS5, HAPIP, ARHGEF24 |
| Gene id |
8997 |
| Description of target |
Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein that interacts with the huntingtin-associated protein 1, which is a huntingtin binding protein that may function in vesicle trafficking. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Swissprot id |
O60229-5 |
| Protein accession num |
NP_001019831.2 |
| Nucleotide accession num |
NM_001024660.3 |
| Protein size |
738 amino acids |
| Molecular weight |
81 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: GRKSFDLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKI |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- KALRN Antibody (ARP81502_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
