| Sku |
AAP80945 |
| Price |
99 |
| Name |
CASK Peptide - middle region (AAP80945) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CASK |
| Alias symbols |
CMG, FGS4, LIN2, TNRC8, CAGH39, CAMGUK, MICPCH, MRXSNA |
| Gene id |
8573 |
| Description of target |
This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, mental retardation and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
O14936-3 |
| Protein accession num |
NP_001119526.1 |
| Nucleotide accession num |
NM_001126054.2 |
| Protein size |
897 amino acids |
| Molecular weight |
98 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: HPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHE |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti-CASK Antibody (ARP80945_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
