| Sku |
AAP76127 |
| Price |
99 |
| Name |
EPHA5 Peptide - N-terminal region (AAP76127) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
EPHA5 |
| Alias symbols |
EPHA5,BSK, EHK1, HEK7, TYRO4, |
| Gene id |
2044 |
| Description of target |
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Swissprot id |
P54756 |
| Protein size |
1037 amino acids |
| Molecular weight |
114kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: IELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTI |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti-EPHA5 Antibody (ARP76127_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
