PDLIM2 Peptide - N-terminal region (AAP75739)

Data Sheet
 
Sku AAP75739
Price 99
Name PDLIM2 Peptide - N-terminal region (AAP75739)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PDLIM2
Alias symbols SLIM, MYSTIQUE
Gene id 64236
Description of target This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Swissprot id Q96JY6
Protein size 352 amino acids
Molecular weight 38kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRT
Partner proteins ACD; POT1; UBC; RELA;
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-PDLI2 Antibody (ARP75739_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com