Sku |
AAP65048 |
Price |
99 |
Name |
SORBS1 Peptide - middle region (AAP65048) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SORBS1 |
Alias symbols |
CAP, FLAF2, R85FL, SH3D5, SORB1, SH3P12 |
Gene id |
10580 |
Description of target |
This gene encodes a CBL-associated protein which functions in the signaling and stimulation of insulin. Mutations in this gene may be associated with human disorders of insulin resistance. Alternative splicing results in multiple transcript variants. |
Swissprot id |
Q9BX66-7 |
Protein accession num |
AAH42612 |
Nucleotide accession num |
NM_001034954.1 |
Protein size |
628 amino acids |
Molecular weight |
69 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: SERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEV |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- SORBS1 Antibody (ARP65048_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |