| Sku |
AAP64960 |
| Price |
$99.00 |
| Name |
GNA11 Peptide - N-terminal region (AAP64960) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
GNA11 |
| Alias symbols |
GNA-11 |
| Gene id |
2767 |
| Description of target |
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C. |
| Swissprot id |
P43444 |
| Protein accession num |
NP_002058 |
| Nucleotide accession num |
NM_002067 |
| Protein size |
359 amino acids |
| Molecular weight |
41kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANA |
| Partner proteins |
ADRA1B,ADRB2,BDKRB2,CHRM2,EDNRA,EDNRB,HTR2A,HTR2B,KDR,MTNR1A,PTGIR,RGS3,TBXA2R,TRPC3,TSHR,EDNRA,EDNRB,MTNR1A,RGS3,UBC |
| Subunit |
alpha-11 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-GNA11 Antibody (ARP64960_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
