Sku |
AAP63609 |
Price |
$99.00 |
Name |
DRD1 Peptide - N-terminal region (AAP63609) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
DRD1 |
Alias symbols |
DADR, DRD1A |
Gene id |
1812 |
Description of target |
This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. |
Swissprot id |
P21728 |
Protein accession num |
NP_000785 |
Nucleotide accession num |
NM_000794 |
Protein size |
446 amino acids |
Molecular weight |
49kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
AAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDS |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-DRD1 Antibody (ARP63609_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |