| Sku |
AAP63486 |
| Price |
$99.00 |
| Name |
CNR2 Peptide - C-terminal region (AAP63486) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CNR2 |
| Alias symbols |
CB2, CX5 |
| Gene id |
1269 |
| Description of target |
The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
| Swissprot id |
P34972 |
| Protein accession num |
NP_001832 |
| Nucleotide accession num |
NM_001841 |
| Protein size |
360 amino acids |
| Molecular weight |
40kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
MVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEA |
| Partner proteins |
GNA15 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CNR2 Antibody (ARP63486_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
