Sku |
AAP63319 |
Price |
$99.00 |
Name |
DPP4 Peptide - C-terminal region (AAP63319) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
DPP4 |
Alias symbols |
ADABP, ADCP2, CD26, DPPIV, TP103 |
Gene id |
1803 |
Description of target |
The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. |
Swissprot id |
P27487 |
Protein accession num |
NP_001926 |
Nucleotide accession num |
NM_001935 |
Protein size |
766 amino acids |
Molecular weight |
84kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH |
Partner proteins |
ADA,CCL11,CCL22,CCL3L1,CCL5,CD4,CPAMD8,CXCL10,CXCL11,CXCL12,CXCL9,CXCR4,DPP4,FAP,GRP,PTPRC,CCL22 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-DPP4 Antibody (ARP63319_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |