DPP4 Peptide - C-terminal region (AAP63319)

Data Sheet
 
Sku AAP63319
Price $99.00
Name DPP4 Peptide - C-terminal region (AAP63319)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene DPP4
Alias symbols ADABP, ADCP2, CD26, DPPIV, TP103
Gene id 1803
Description of target The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Swissprot id P27487
Protein accession num NP_001926
Nucleotide accession num NM_001935
Protein size 766 amino acids
Molecular weight 84kDa
Species reactivity Human
Application IHC, WB
Peptide sequence DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH
Partner proteins ADA,CCL11,CCL22,CCL3L1,CCL5,CD4,CPAMD8,CXCL10,CXCL11,CXCL12,CXCL9,CXCR4,DPP4,FAP,GRP,PTPRC,CCL22
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-DPP4 Antibody (ARP63319_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com