Sku |
AAP63168 |
Price |
$99.00 |
Name |
SPARC Peptide - C-terminal region (AAP63168) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SPARC |
Alias symbols |
ON |
Gene id |
6678 |
Description of target |
Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM). |
Swissprot id |
P09486 |
Protein accession num |
NP_003109 |
Nucleotide accession num |
NM_003118 |
Protein size |
303 amino acids |
Molecular weight |
33kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL |
Partner proteins |
COL13A1,COL1A1,COL1A2,COL2A1,COL3A1,CTSK,FN1,HSPG2,PDGFA,PLAT,PLG,SDC2,SPARC,TGFB1,TGM2,THBS1,VEGFA,COL1A1,COL3A1,COL5A1,PDGFB,PLG,VEGFA |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-SPARC Antibody (ARP63168_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |