ADCK2 Peptide - middle region (AAP63131)

Data Sheet
 
Sku AAP63131
Price $99.00
Name ADCK2 Peptide - middle region (AAP63131)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ADCK2
Alias symbols AARF, MGC20727
Gene id 90956
Description of target The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
Swissprot id Q7Z695
Protein accession num NP_443085
Nucleotide accession num NM_052853
Protein size 626 amino acids
Molecular weight 68kDa
Species reactivity Human
Application IHC, WB
Peptide sequence LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ADCK2 Antibody (ARP63131_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com