Sku |
AAP62285 |
Price |
$99.00 |
Name |
MTG1 Peptide - N-terminal region (AAP62285) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
MTG1 |
Alias symbols |
GTP, GTPBP7, RP11-108K14.2 |
Gene id |
92170 |
Description of target |
MTG1 is a mitochondrial GTPase. MTG1 may be involved in assembly of the large ribosomal subunit. |
Swissprot id |
Q9BT17-2 |
Protein accession num |
NP_612393 |
Nucleotide accession num |
NM_138384 |
Protein size |
267 amino acids |
Molecular weight |
29kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
IMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYC |
Partner proteins |
STRN4,ICT1,STRN4 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-MTG1 Antibody (ARP62285_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |