MTG1 Peptide - N-terminal region (AAP62285)

Data Sheet
 
Sku AAP62285
Price $99.00
Name MTG1 Peptide - N-terminal region (AAP62285)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene MTG1
Alias symbols GTP, GTPBP7, RP11-108K14.2
Gene id 92170
Description of target MTG1 is a mitochondrial GTPase. MTG1 may be involved in assembly of the large ribosomal subunit.
Swissprot id Q9BT17-2
Protein accession num NP_612393
Nucleotide accession num NM_138384
Protein size 267 amino acids
Molecular weight 29kDa
Species reactivity Human
Application WB
Peptide sequence IMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYC
Partner proteins STRN4,ICT1,STRN4
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MTG1 Antibody (ARP62285_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com