| Sku |
AAP61404 |
| Old sku |
AAPP47522 |
| Price |
$99.00 |
| Name |
MAGI2 Peptide - N-terminal region (AAP61404) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MAGI2 |
| Alias symbols |
ACVRIP1, AIP1, ARIP1, MAGI-2, SSCAM, AIP-1 |
| Gene id |
9863 |
| Description of target |
The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. |
| Swissprot id |
Q86UL8 |
| Protein accession num |
NP_036433 |
| Nucleotide accession num |
NM_012301 |
| Protein size |
1455 amino acids |
| Molecular weight |
160kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
EEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEE |
| Partner proteins |
ATN1,ACVR2A,ADRB1,ATN1,CTNNB1,CTNND2,DLL1,DSCAML1,GRID2,MAGI2,PLXNB3,PTEN,RAPGEF2,SMAD3,TGFA,ACVR2A,ATN1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MAGI2 Antibody (ARP61404_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
