| Sku |
AAP61205 |
| Old sku |
AAPP47357 |
| Price |
$99.00 |
| Name |
UNG Peptide - C-terminal region (AAP61205) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
UNG |
| Alias symbols |
DGU, DKFZp781L1143, HIGM4, UDG, UNG1, UNG15, UNG2 |
| Gene id |
7374 |
| Description of target |
This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. |
| Swissprot id |
P13051 |
| Protein accession num |
NP_550433 |
| Nucleotide accession num |
NM_080911 |
| Protein size |
313 amino acids |
| Molecular weight |
34kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
GWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFL |
| Partner proteins |
PCNA,PPM1D,PCNA,RPA2,RPA2,UBC |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-UNG Antibody (ARP61205_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
