| Sku |
AAP60969 |
| Old sku |
AAPP47112 |
| Price |
$99.00 |
| Name |
ACTA1 Peptide - N-terminal region (AAP60969) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
ACTA1 |
| Alias symbols |
ACTA, ASMA, CFTD, CFTD1, CFTDM, MPFD, NEM1, NEM2, NEM3 |
| Gene id |
58 |
| Description of target |
The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause nemaline myopathy type 3, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects. |
| Swissprot id |
P68133 |
| Protein accession num |
NP_001091 |
| Nucleotide accession num |
NM_001100 |
| Protein size |
377 amino acids |
| Molecular weight |
42kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVA |
| Partner proteins |
ABL1,ACTA1,ACTR10,ACTR1B,ADSS,AFAP1,AIF1,CCIN,CCT4,CCT5,CFL1,CLIC5,CNN1,CORO2B,COTL1,CTNND1,CTTN,CYFIP1,CYTH1,DLG1,DMD,DNASE1,DNMBP,DTNA,EGFR,EPB41,EPB41L2,EPS8,FGD4,FHOD1,FSCN1,GAS2,GAS7,GC,GSN,HCLS1,HIP1R,IQGAP1,ITGA2,ITPKA,JUB,KIF23,KLHL20,LASP1,MACF1, |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-ACTA1 Antibody (ARP60969_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
