| Sku |
AAP60508 |
| Old sku |
AAPP46804 |
| Price |
$99.00 |
| Name |
SLA2 Peptide - N-terminal region (AAP60508) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SLA2 |
| Alias symbols |
C20orf156, FLJ21992, MGC49845, SLAP-2, SLAP2, MARS |
| Gene id |
84174 |
| Description of target |
This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c. |
| Swissprot id |
Q9H6Q3 |
| Protein accession num |
NP_115590 |
| Nucleotide accession num |
NM_032214 |
| Protein size |
261 amino acids |
| Molecular weight |
28kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG |
| Partner proteins |
CBL,CD247,ZAP70,CBL,CD247,CSF1,LAMC2,ZAP70 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-SLA2 Antibody (ARP60508_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
