| Sku |
AAP60375 |
| Old sku |
AAPP46554 |
| Price |
$99.00 |
| Name |
STYXL1 Peptide - middle region (AAP60375) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
STYXL1 |
| Alias symbols |
DUSP24, MK-STYX |
| Gene id |
51657 |
| Description of target |
STYXL1 is a probable pseudophosphatase. It contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases. |
| Swissprot id |
Q9Y6J8 |
| Protein accession num |
NP_057170 |
| Nucleotide accession num |
NM_016086 |
| Protein size |
313 amino acids |
| Molecular weight |
36kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA |
| Partner proteins |
FLI1,TGFBR1,AES,ATXN10,EHD4,PSPH,RPS29,SMC1A |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-STYXL1 Antibody (ARP60375_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
