Sku |
AAP59983 |
Old sku |
AAPP46341 |
Price |
$99.00 |
Name |
AGTR2 Peptide - N-terminal region (AAP59983) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
AGTR2 |
Alias symbols |
AT2, ATGR2, MRX88 |
Gene id |
186 |
Description of target |
The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. |
Swissprot id |
P50052 |
Protein accession num |
NP_000677 |
Nucleotide accession num |
NM_000686 |
Protein size |
363 amino acids |
Molecular weight |
41kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT |
Partner proteins |
ACE,AGT,ERBB3,GNAI2,GNAI3,MTUS1,PIK3CB,ZBTB16,AGTRAP,MTUS1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-AGTR2 Antibody (ARP59983_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |