Sku |
AAP59350 |
Old sku |
AAPP45447 |
Price |
$99.00 |
Name |
COPS6 Peptide - middle region (AAP59350) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
COPS6 |
Alias symbols |
CSN6, MOV34-34KD |
Gene id |
10980 |
Description of target |
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. |
Swissprot id |
Q7L5N1 |
Protein accession num |
NP_006824 |
Nucleotide accession num |
NM_006833 |
Protein size |
327 amino acids |
Molecular weight |
36kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV |
Partner proteins |
COPS2,COPS3,COPS4,COPS5,COPS6,BTBD2,C1orf174,C4orf17,CCDC106,CDH10,CDKN2C,CHRNB1,COPS2,COPS3,COPS4,COPS5,COPS6,COPS8,COX17,COX5A,CRELD1,CUL1,CUL5,DIS3L2,EDN1,EIF3E,EMD,EP300,ERH,FAU,GPS1,HMOX2,LAMA4,LPL,MAP7D1,MIF,MNAT1,MYCBP,NR3C1,ORAI2,PAEP,PAFAH1B3,PBX |
Subunit |
6 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-COPS6 Antibody, made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |