COPS6 Peptide - middle region (AAP59350)

Data Sheet
 
Sku AAP59350
Old sku AAPP45447
Price $99.00
Name COPS6 Peptide - middle region (AAP59350)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene COPS6
Alias symbols CSN6, MOV34-34KD
Gene id 10980
Description of target The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr.
Swissprot id Q7L5N1
Protein accession num NP_006824
Nucleotide accession num NM_006833
Protein size 327 amino acids
Molecular weight 36kDa
Species reactivity Human
Application WB
Peptide sequence DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV
Partner proteins COPS2,COPS3,COPS4,COPS5,COPS6,BTBD2,C1orf174,C4orf17,CCDC106,CDH10,CDKN2C,CHRNB1,COPS2,COPS3,COPS4,COPS5,COPS6,COPS8,COX17,COX5A,CRELD1,CUL1,CUL5,DIS3L2,EDN1,EIF3E,EMD,EP300,ERH,FAU,GPS1,HMOX2,LAMA4,LPL,MAP7D1,MIF,MNAT1,MYCBP,NR3C1,ORAI2,PAEP,PAFAH1B3,PBX
Subunit 6
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-COPS6 Antibody, made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com