| Sku |
AAP58434 |
| Old sku |
AAPP34805 |
| Price |
$99.00 |
| Name |
CAPNS1 Peptide - middle region (AAP58434) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CAPNS1 |
| Alias symbols |
30K, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1 |
| Gene id |
826 |
| Description of target |
Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene. |
| Swissprot id |
P04632 |
| Protein accession num |
NP_001003962 |
| Nucleotide accession num |
NM_001003962 |
| Protein size |
268 amino acids |
| Molecular weight |
29kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL |
| Partner proteins |
CAPN1,ARHGEF6,ARR3,ATP5J2,CAPN1,CAPN2,CAST,CDK4,DRG1,GET4,GNB2,IL2RG,LRRCC1,RAB1A,TERF1,ARR3,ATP5J2,CAPN2,CDK4,DRG1,GET4,GNB2,IL2RG,MEPCE,RAB1A,RUVBL1,TERF1 |
| Subunit |
1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CAPNS1 Antibody(ARP58434_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
