| Sku |
AAP57798 |
| Old sku |
AAPP44117 |
| Price |
$99.00 |
| Name |
RAC1 Peptide - middle region (AAP57798) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
RAC1 |
| Alias symbols |
MGC111543, MIG5, TC-25, p21-Rac1, Rac-1 |
| Gene id |
5879 |
| Description of target |
The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
P60763 |
| Protein accession num |
NP_008839 |
| Nucleotide accession num |
NM_006908 |
| Protein size |
192 amino acids |
| Molecular weight |
21kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
| Partner proteins |
TIAM1,ARHGDIG,ACTA1,ACTB,AKT1,ARFIP2,ARHGAP15,ARHGAP31,ARHGDIA,ARHGDIB,ARHGDIG,ARHGEF2,ARHGEF25,ARHGEF7,BAIAP2,CASP3,CASP7,CAV1,CDC42BPG,CDC42SE1,CDC42SE2,CHN1,CHN2,CYBA,CYBB,CYFIP1,DEF6,DIAPH1,DOCK1,DOCK2,DOCK8,DVL1,DVL2,EIF2AK2,FHOD1,FLNA,FMNL1,ICMT,IFN |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-RAC1 Antibody(ARP57798_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
