| Sku |
AAP57298 |
| Old sku |
AAPP44646 |
| Price |
$99.00 |
| Name |
TUBA8 Peptide - N-terminal region (AAP57298) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
TUBA8 |
| Alias symbols |
TUBAL2 |
| Gene id |
51807 |
| Description of target |
This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants. |
| Swissprot id |
Q9NY65 |
| Protein accession num |
NP_061816 |
| Nucleotide accession num |
NM_018943 |
| Protein size |
449 amino acids |
| Molecular weight |
50kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD |
| Partner proteins |
GRM7,MYC,PXN,SIAH1,TCP1,MEPCE |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-TUBA8 Antibody(ARP57298_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
