| Sku |
AAP56609 |
| Old sku |
AAPP39316 |
| Price |
$99.00 |
| Name |
NDUFS1 Peptide - middle region (AAP56609) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NDUFS1 |
| Alias symbols |
CI-75Kd, MGC26839, PRO1304, CI-75k |
| Gene id |
4719 |
| Description of target |
The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. |
| Swissprot id |
P28331 |
| Protein accession num |
NP_004997 |
| Nucleotide accession num |
NM_005006 |
| Protein size |
727 amino acids |
| Molecular weight |
77kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE |
| Partner proteins |
CASP3,MDH2,CASP3,TNFAIP3 |
| Subunit |
, mitochondrial |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NDUFS1 Antibody(ARP56609_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
