| Sku |
AAP55415 |
| Old sku |
AAPP44423 |
| Price |
$99.00 |
| Name |
CCNDBP1 Peptide - middle region (AAP55415) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CCNDBP1 |
| Alias symbols |
DIP1, GCIP, HHM |
| Gene id |
23582 |
| Description of target |
This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene. |
| Protein accession num |
NP_411241 |
| Nucleotide accession num |
NM_037370 |
| Protein size |
232 amino acids |
| Molecular weight |
26kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS |
| Partner proteins |
CCND1,GRAP2,MRPS9,ZNF334,CCND1,DAPK1,GRAP2,SIRT6,SYF2,ZNF334 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CCNDBP1 Antibody(ARP55415_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
