RAB35 Peptide - middle region (AAP52268)

Data Sheet
 
Sku AAP52268
Old sku AAPP44029
Price $99.00
Name RAB35 Peptide - middle region (AAP52268)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene RAB35
Alias symbols H-ray, RAB1C, RAY
Gene id 11021
Description of target RAB35 possesses GTPase activity.
Swissprot id Q15286
Protein accession num NP_006852
Nucleotide accession num NM_006861
Protein size 201 amino acids
Molecular weight 23kDa
Species reactivity Human
Application WB
Peptide sequence GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK
Partner proteins C2orf44,CBR3,GNPAT,IDH3B,PTPRS,TBPL1,ALK,CBR3,TBPL1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-RAB35 Antibody(ARP52268_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com