| Sku |
AAP44223 |
| Old sku |
AAPP25603 |
| Price |
$99.00 |
| Name |
G6pc Peptide - N-terminal region (AAP44223) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
G6pc |
| Alias symbols |
AW107337, G6Pase, G6pt, Glc-6-Pase |
| Gene id |
14377 |
| Description of target |
G6pc hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels. |
| Swissprot id |
P35576 |
| Protein accession num |
NP_032087 |
| Nucleotide accession num |
NM_008061 |
| Protein size |
357 amino acids |
| Molecular weight |
40kDa |
| Species reactivity |
Mouse |
| Application |
WB |
| Peptide sequence |
DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
| Partner proteins |
Foxo1,Ppargc1a,Sirt1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-G6pc Antibody (ARP44223_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
