SLC25A4 Peptide - N-terminal region (AAP43818)

Data Sheet
 
Sku AAP43818
Old sku AAPS14103
Price $99.00
Name SLC25A4 Peptide - N-terminal region (AAP43818)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SLC25A4
Alias symbols ANT, ANT1, PEO2, PEO3, T1, AAC1
Gene id 291
Description of target This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
Swissprot id Q05962
Protein accession num NP_001142
Nucleotide accession num NM_001151
Protein size 298 amino acids
Molecular weight 33kDa
Species reactivity Human
Application IHC, WB
Peptide sequence LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Partner proteins AR,BAX,NFKBIA,NR3C1,PPID,PPIF,PRKCE,BAX,MGMT,PPIF,PRKCE
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-SLC25A4 Antibody(ARP43818_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com