Sku |
AAP43818 |
Old sku |
AAPS14103 |
Price |
$99.00 |
Name |
SLC25A4 Peptide - N-terminal region (AAP43818) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
SLC25A4 |
Alias symbols |
ANT, ANT1, PEO2, PEO3, T1, AAC1 |
Gene id |
291 |
Description of target |
This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy. |
Swissprot id |
Q05962 |
Protein accession num |
NP_001142 |
Nucleotide accession num |
NM_001151 |
Protein size |
298 amino acids |
Molecular weight |
33kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
Partner proteins |
AR,BAX,NFKBIA,NR3C1,PPID,PPIF,PRKCE,BAX,MGMT,PPIF,PRKCE |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-SLC25A4 Antibody(ARP43818_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |