Zbtb7a Peptide - C-terminal region (AAP39212)

Data Sheet
 
Sku AAP39212
Price $99.00
Name Zbtb7a Peptide - C-terminal region (AAP39212)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Zbtb7a
Alias symbols 9030619K07Rik, 9130006G12Rik, AI452336, FBI-1, Lrf, Pokemon, Zbtb7
Gene id 16969
Description of target Zbtb7a plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Zbtb7a specifically represses the transcription of the CDKN2A gene. Zbtb7a efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Zbtb7a binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
Swissprot id O88939
Protein accession num NP_034861
Nucleotide accession num NM_010731
Protein size 569 amino acids
Molecular weight 60kDa
Species reactivity Mouse, Human
Application WB
Peptide sequence PPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSG
Partner proteins Cdkn2a
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Zbtb7a Antibody (ARP39212_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com