Sku |
AAP39212 |
Price |
$99.00 |
Name |
Zbtb7a Peptide - C-terminal region (AAP39212) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
Zbtb7a |
Alias symbols |
9030619K07Rik, 9130006G12Rik, AI452336, FBI-1, Lrf, Pokemon, Zbtb7 |
Gene id |
16969 |
Description of target |
Zbtb7a plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Zbtb7a specifically represses the transcription of the CDKN2A gene. Zbtb7a efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Zbtb7a binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'. |
Swissprot id |
O88939 |
Protein accession num |
NP_034861 |
Nucleotide accession num |
NM_010731 |
Protein size |
569 amino acids |
Molecular weight |
60kDa |
Species reactivity |
Mouse, Human |
Application |
WB |
Peptide sequence |
PPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSG |
Partner proteins |
Cdkn2a |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-Zbtb7a Antibody (ARP39212_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |