ERCC3 Peptide - N-terminal region (AAP37963)

Data Sheet
 
Sku AAP37963
Old sku AAPP23267
Price $99.00
Name ERCC3 Peptide - N-terminal region (AAP37963)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ERCC3
Alias symbols BTF2, GTF2H, RAD25, TFIIH, XPB
Gene id 2071
Description of target ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Swissprot id P19447
Protein accession num NP_000113
Nucleotide accession num NM_000122
Protein size 782 amino acids
Molecular weight 89kDa
Species reactivity Human
Application WB
Peptide sequence MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Partner proteins CCND1,IRF1,TAF7,TP53,BCR,CCNH,CDK7,ERCC2,GTF2E1,GTF2E2,GTF2H1,GTF2H2,GTF2H3,GTF2H4,GTF2H5,MNAT1,PSMC5,RAD52,TP53,XPC,ATF7IP,BCR,CCNH,CDK7,ERCC2,ERCC5,GCN1L1,GTF2E1,GTF2E2,GTF2H1,GTF2H2,GTF2H3,GTF2H4,GTF2H5,MNAT1,PSMC5,TP53,XPC,ZSCAN1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ERCC3 Antibody(ARP37963_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com