Sku |
AAP37963 |
Old sku |
AAPP23267 |
Price |
$99.00 |
Name |
ERCC3 Peptide - N-terminal region (AAP37963) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
ERCC3 |
Alias symbols |
BTF2, GTF2H, RAD25, TFIIH, XPB |
Gene id |
2071 |
Description of target |
ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription. |
Swissprot id |
P19447 |
Protein accession num |
NP_000113 |
Nucleotide accession num |
NM_000122 |
Protein size |
782 amino acids |
Molecular weight |
89kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG |
Partner proteins |
CCND1,IRF1,TAF7,TP53,BCR,CCNH,CDK7,ERCC2,GTF2E1,GTF2E2,GTF2H1,GTF2H2,GTF2H3,GTF2H4,GTF2H5,MNAT1,PSMC5,RAD52,TP53,XPC,ATF7IP,BCR,CCNH,CDK7,ERCC2,ERCC5,GCN1L1,GTF2E1,GTF2E2,GTF2H1,GTF2H2,GTF2H3,GTF2H4,GTF2H5,MNAT1,PSMC5,TP53,XPC,ZSCAN1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-ERCC3 Antibody(ARP37963_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |