EIF2AK2 Peptide - middle region (AAP36709)

Data Sheet
 
Sku AAP36709
Old sku AAPP08602
Price $99.00
Name EIF2AK2 Peptide - middle region (AAP36709)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene EIF2AK2
Alias symbols EIF2AK1, MGC126524, PKR, PRKR
Gene id 5610
Description of target EIF2AK2 might play a role in ER stress-induced apoptosis and in Alzheimer's disease. Alzheimer cases show prominent EIF2AK2 activation in association with neuritic plaques and pyramidal neurons in the hippocampus and neocortex.
Swissprot id P19525
Protein accession num NP_002750
Nucleotide accession num NM_002759
Protein size 551 amino acids
Molecular weight 62kDa
Species reactivity Human
Application WB
Peptide sequence QVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDG
Partner proteins EIF2S1,HIV2gp5,HTT,PRKRA,tat,CASP3,CASP7,CASP8,CDC42,CHUK,DNAJC3,EIF2AK2,EIF2S1,ELF2,HSP90AA1,HSPA1A,IKBKB,ILF3,JAK1,MAP3K5,MAP3K7,METAP2,NFKBIA,NPM1,PDGFRB,PPP1CA,PPP1CC,PPP2R5A,PRKRA,PRKRIP1,PRKRIR,PTGES3,RAC1,STAT1,STAT3,STRBP,TAB2,TARBP2,TIRAP,TP53,TY
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-EIF2AK2 Antibody(ARP36709_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com