Sku |
AAP36709 |
Old sku |
AAPP08602 |
Price |
$99.00 |
Name |
EIF2AK2 Peptide - middle region (AAP36709) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
EIF2AK2 |
Alias symbols |
EIF2AK1, MGC126524, PKR, PRKR |
Gene id |
5610 |
Description of target |
EIF2AK2 might play a role in ER stress-induced apoptosis and in Alzheimer's disease. Alzheimer cases show prominent EIF2AK2 activation in association with neuritic plaques and pyramidal neurons in the hippocampus and neocortex. |
Swissprot id |
P19525 |
Protein accession num |
NP_002750 |
Nucleotide accession num |
NM_002759 |
Protein size |
551 amino acids |
Molecular weight |
62kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
QVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDG |
Partner proteins |
EIF2S1,HIV2gp5,HTT,PRKRA,tat,CASP3,CASP7,CASP8,CDC42,CHUK,DNAJC3,EIF2AK2,EIF2S1,ELF2,HSP90AA1,HSPA1A,IKBKB,ILF3,JAK1,MAP3K5,MAP3K7,METAP2,NFKBIA,NPM1,PDGFRB,PPP1CA,PPP1CC,PPP2R5A,PRKRA,PRKRIP1,PRKRIR,PTGES3,RAC1,STAT1,STAT3,STRBP,TAB2,TARBP2,TIRAP,TP53,TY |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-EIF2AK2 Antibody(ARP36709_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |