| Sku |
AAP35728 |
| Price |
$99.00 |
| Name |
Med21 Peptide - N-terminal region (AAP35728) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
Med21 |
| Alias symbols |
0610007L03Rik, AI449604, D19234, D6Ertd782e, Srb7, Surb7 |
| Gene id |
108098 |
| Description of target |
Med21 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. |
| Swissprot id |
Q9CQ39 |
| Protein accession num |
NP_079591 |
| Nucleotide accession num |
NM_025315 |
| Protein size |
144 amino acids |
| Molecular weight |
15kDa |
| Species reactivity |
Mouse, Human |
| Application |
WB, CHIP |
| Peptide sequence |
FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD |
| Partner proteins |
Nfe2 |
| Subunit |
21 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-Med21 Antibody (ARP35728_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
