Sku |
AAP32607 |
Old sku |
AAPP03615 |
Price |
$99.00 |
Name |
CNOT7 Peptide - middle region (AAP32607) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
CNOT7 |
Alias symbols |
CAF1, hCAF-1 |
Gene id |
29883 |
Description of target |
CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. |
Swissprot id |
Q9UIV1 |
Protein accession num |
NP_037486 |
Nucleotide accession num |
NM_013354 |
Protein size |
285 amino acids |
Molecular weight |
33kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG |
Partner proteins |
BTG1,BTG2,BTG3,CDK1,CDK2,CDK4,CDK6,CNOT6,TOB1,TOB2,BTG1,BTG2,CDK1,CDK2,CDK4,HOXD4,IKBKG,PABPC1,TOB1,TOB2 |
Subunit |
7 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-CNOT7 Antibody(ARP32607_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |