| Product Number |
ARP43277_P050 |
| Product Page |
www.avivasysbio.com/hace1-antibody-middle-region-arp43277-p050.html |
| Name |
HACE1 Antibody - middle region (ARP43277_P050) |
| Protein Size (# AA) |
909 amino acids |
| Molecular Weight |
102kDa |
| NCBI Gene Id |
57531 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 |
| Alias Symbols |
SPPRS |
| Peptide Sequence |
Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,L., (2007) Nat. Med. 13 (9), 1060-1069 |
| Description of Target |
HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation. |
| Protein Interactions |
UBE2L3; UBC; OPTN; Unc45b; Flna; Actn1; Cald1; Lima1; Actn4; Tpm3; Tmod3; Coro1c; Vim; Vcl; Tubb5; Tubb4a; Tpm2; Tpm1; Tcp1; Plec; Sqstm1; Npm1; Myh9; Marcks; Hspa9; Hsp90ab1; Hspd1; Hspa8; Fhl1; Csrp1; Cnn2; Cct8; Serpinh1; Capzb; Capza2; Capza1; Actg1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HACE1 (ARP43277_P050) antibody |
| Blocking Peptide |
For anti-HACE1 (ARP43277_P050) antibody is Catalog # AAP43277 (Previous Catalog # AAPP11352) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HACE1 |
| Uniprot ID |
Q8IYU2 |
| Protein Name |
E3 ubiquitin-protein ligase HACE1 |
| Protein Accession # |
NP_065822 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020771 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HACE1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-HACE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate |
|
