website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

HACE1 antibody - middle region (ARP43277_P050)

Description of Target:
HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.
Gene Symbol:
HACE1
Official Gene Full Name:
HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
NCBI Gene Id:
57531
Alias Symbols:
-
Tissue Tool:
Find tissues and cell lines supported to express HACE1.
Protein Accession #:
NP_065822
Nucleotide Accession#:
NM_020771
Swissprot Id:
Q8IYU2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
E3 ubiquitin-protein ligase HACE1
Protein Size (# AA):
909
Molecular Weight:
102kDa
Application:
WB
Partner Proteins:
CD4
Immunogen:
The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
HACE1 antibody - middle region (ARP43277_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Pig, Rat, Dog, Bovine, Horse, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-HACE1 antibody
- ARP43277_P050
Peptide Sequence:
Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV
Blocking Peptide:
For anti-HACE1 antibody is Catalog # AAP43277 (Previous Catalog # AAPP11352)
Key Reference:
Zhang,L., (2007) Nat. Med. 13 (9), 1060-1069
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-HACE1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question