HDAC9 Antibody - C-terminal region (ARP42788_T100)

• Product Number: ARP42788_T100
• Name: HDAC9 Antibody - C-terminal region (ARP42788_T100)
• Protein Size (# AA): 590 amino acids
• Molecular Weight: 65 kDa
• NCBI Gene Id: 9734
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Histone deacetylase 9
• Alias Symbols: HD7, HD9, HD7b, HDAC, HDRP, MITR, HDAC7, HDAC7B, HDAC9B, HDAC9FL
• Peptide Sequence: Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Han,A., (2005) J. Mol. Biol. 345 (1), 91-102
• Description of Target: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.
• Protein Interactions: NOP2; MKI67; EIF6; RCC1; ADAR; TOP1; TMPO; FIP1L1; CCAR2; TPX2; RBM14; ZC3H11A; HDAC9; NUP93; SMC3; H1FX; TPR; HINT1; CTBP1; BCL6; Zfp521; TRIM29; TP53; MAML1; SMARCA4; PARP1; CEBPB; H3F3A; RL2; CAMK1; YWHAE; HDAC1; SFN; MEF2B; ANKRA2; RFXANK; PKD1; SYK;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-HDAC9 (ARP42788_T100) antibody is Catalog # AAP42788 (Previous Catalog # AAPS10202)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9
• Uniprot ID: Q9UKV0-3, Q9UKV0-8, Q9UKV0-9, Q9UKV0-10, Q9UKV0-11
• Protein Name: Histone deacetylase 9
• Publications:

  Hang, C. T. et al. Chromatin regulation by Brg1 underlies heart muscle development and disease. Nature 466, 62-7 (2010). 20596014

  Milde, T. et al. HDAC5 and HDAC9 in medulloblastoma: novel markers for risk stratification and role in tumor cell growth. Clin. Cancer Res. 16, 3240-52 (2010). 20413433

  Spallotta, F. et al. Detrimental effect of class-selective histone deacetylase inhibitors during tissue regeneration following hindlimb ischemia. J. Biol. Chem. 288, 22915-29 (2013). 23836913

• Sample Type Confirmation:

  HDAC9 is supported by BioGPS gene expression data to be expressed in A172

• Protein Accession #: NP_055522
• Purification: Protein A purified
• Nucleotide Accession #: NM_014707
• Tested Species Reactivity: Human
• Gene Symbol: HDAC9
• Predicted Species Reactivity: Human, Mouse, Guinea Pig, Sheep
• Application: CHIP, IHC, WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 100%; Human: 100%; Mouse: 100%; Sheep: 100%
• Image 1: Human Lung
  
  Rabbit Anti-HDAC9 Antibody
  Catalog Number: ARP42788
  Paraffin Embedded Tissue: Human alveolar cell
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: HCT116
  
  Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region (ARP42788_T100) and HCT116 Cells
• Image 3: Human kidney
  
  Human kidney
• Image 4: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The c-terminal peptide used to generate this antibody is not present in the full length canonical isoform, but is present in several HDAC9 isoforms below 654 amino acids. In these samples, isoform 8 of 65 kDa is recognized as well as possibly isoform 11 at 57 kDa.