CLEC4M Antibody - N-terminal region (ARP42396_T100)

• Product Number: ARP42396_T100
• Name: CLEC4M Antibody - N-terminal region (ARP42396_T100)
• Protein Size (# AA): 399 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 10332
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: C-type lectin domain family 4, member M
• Alias Symbols: CD299, LSIGN, CD209L, L-SIGN, DCSIGNR, HP10347, DC-SIGN2, DC-SIGNR
• Peptide Sequence: Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Liu,H., (2006) J. Infect. Dis. 193 (5), 698-702
• Description of Target: CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
• Protein Interactions: TLR2; MME; CLEC4M; CD209; ICAM3; ITGAM; AP2M1; HCVgp1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLEC4M (ARP42396_T100) antibody is Catalog # AAP42396 (Previous Catalog # AAPP24747)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLEC4M
• Uniprot ID: Q9H2X3
• Protein Name: C-type lectin domain family 4 member M
• Protein Accession #: NP_055072
• Purification: Protein A purified
• Nucleotide Accession #: NM_014257
• Tested Species Reactivity: Human
• Gene Symbol: CLEC4M
• Predicted Species Reactivity: Human, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 86%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-CLEC4M Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysate