OTC Antibody - N-terminal region (ARP41766_T100)

• Product Number: ARP41766_T100
• Name: OTC Antibody - N-terminal region (ARP41766_T100)
• Protein Size (# AA): 354 amino acids
• Molecular Weight: 40 kDa
• NCBI Gene Id: 5009
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Ornithine carbamoyltransferase
• Alias Symbols: OCTD, OTCD
• Peptide Sequence: Synthetic peptide located within the following region: AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tanaka,A., (2005) J. Gastroenterol. 40 (1), 106-107
• Description of Target: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.
• Protein Interactions: OTC; TOMM20;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-OTC (ARP41766_T100) antibody is Catalog # AAP41766 (Previous Catalog # AAPP10814)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTC
• Uniprot ID: P00480
• Protein Name: Ornithine carbamoyltransferase, mitochondrial
• Publications:

  Hallows, W. C. et al. Sirt3 promotes the urea cycle and fatty acid oxidation during dietary restriction. Mol. Cell 41, 139-49 (2011). 21255725

  Walters, M. W. & Wallace, K. B. Urea cycle gene expression is suppressed by PFOA treatment in rats. Toxicol. Lett. 197, 46-50 (2010). 20452409

  Yu, W. et al. Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals. J. Biol. Chem. 284, 13669-75 (2009). 19318352

• Protein Accession #: NP_000522
• Purification: Protein A purified
• Nucleotide Accession #: NM_000531
• Tested Species Reactivity: Human
• Gene Symbol: OTC
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Image 1: Human HepG2
  
  Host: Rabbit
  Target Name: OTC
  Sample Tissue: Human HepG2
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Intestine
  
  Rabbit Anti-OTC Antibody
  Catalog Number: ARP41766
  Paraffin Embedded Tissue: Human Intestine
  Cellular Data: Epithelial cells of intestinal villas
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X